| Sub Cat | Epitope | Isotype | Application | |
|---|---|---|---|---|
| V3S-1124-YC847 | In the LGLFSTIHDSIQYVQKNAGKLTTTIGKLCA (aa 321 to 350 of GPC3). | IgG1 | WB; ELISA | |
| V3S-0522-YC1274 | In the residues from 510 to 560. | IgG | ELISA; WB; FC; IHC |
| Description | This product is a recombinant Mouse antibody provided by CreativeBiolabs. The antibody is specific for Glypican 3. It can be used for Glypican 3 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultrapurified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg. |
| Clonality | Monoclonal |
| Host Species | Mouse |
| Target Species | Human |
| Epitope | The epitope is in the LGLFSTIHDSIQYVQKNAGKLTTTIGKLCA (aa 321 to 350 of GPC3). |
| Isotype | IgG1 |
| Expression Species | HEK293F or CHO Cell line |
| Conjugation | Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form. |
| Purity | >95%, determined by SDS-PAGE and SEC-HPLC |
| Endotoxin | <1 EU/mg, determined by LAL method |
| Purification | Purified with Protein A or G affinity chromatography |
| Sterility | 0.2 μM filtered |
| Formulation | PBS, pH 7.4 |
| Preservation | No preservatives |
| Stabilizer | No stabilizers |
| Storage | Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
| Application | WB; ELISA |
| ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
| WB | Western Blot Protocol |
| FC | Flow Cytometry Protocol |