| Sub Cat | Epitope | Isotype | |
|---|---|---|---|
| V3S-1124-YC1539 | Located in the sequence: FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF. | IgG1 kappa | |
| V3S-1022-YC3576 | Located in the sequence: LSVDLGYAYLKGKKVHFKEVKTIGDKRTL. | IgG2b kappa | |
| V3S-1022-YC3577 | Located in the sequence: FKEAQQAAGGFITTTANYTSQAHANLYGLNLNYSF. | IgG3 |
| Description | This product is a recombinant Mouse antibody provided by CreativeBiolabs. The antibody is specific for H. influenzae Outer membrane protein P1. It can be used for H. influenzae OMPP1 detection in Inhibition Assay (Inhib), Enzyme-linked Immunosorbent Assay (ELISA), Western Blot (WB). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg. |
| Clonality | Monoclonal |
| Host Species | Mouse |
| Target Species | H. influenzae Serotype B |
| Epitope | Located in the sequence: FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF. |
| Isotype | IgG1 kappa |
| Expression Species | HEK293F or CHO Cell line |
| Conjugation | Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form. |
| Purity | >95%, determined by SDS-PAGE and SEC-HPLC |
| Endotoxin | <1 EU/mg, determined by LAL method |
| Purification | Purified with Protein A or G affinity chromatography |
| Sterility | 0.2 μM filtered |
| Formulation | PBS, pH 7.4 |
| Preservation | No preservatives |
| Stabilizer | No stabilizers |
| Storage | Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
| Application | Inhib; ELISA; WB |
| ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
| WB | Western Blot Protocol |
| FC | Flow Cytometry Protocol |
| Target | H. influenzae OMPP1 |
| Alternative Name | ompP1; Outer membrane protein P1; H. influenzae Serotype B OMPP1; Haemophilus influenzae Serotype B |
| UniProt | Q9KHH5 |
| Research Area | Microbiology |
