Description |
This product is a recombinant Human antibody provided by CreativeBiolabs. The antibody is specific for Clostridium botulinum Botulinum neurotoxin type A precursor. It can be used for C. botulinum botA detection in Enzyme-linked Immunosorbent Assay (ELISA), Neutralization (Neut). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg. |
Clonality |
Monoclonal |
Host Species |
Human |
Target Species |
Clostridium botulinum A str. Hall |
Epitope |
Located in the sequence: NLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVM. |
Affinity |
The affinity is in nanomolar range, about 3.9 nM, determined by surface plasmon resonance. |
Isotype |
IgG1 |