Description | This product is a recombinant Human antibody provided by CreativeBiolabs. The antibody is specific for Complement component 5a receptor 1. It can be used for C5AR1 detection in Enzyme-linked Immunosorbent Assay (ELISA). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg. |
Clonality | Monoclonal |
Host Species | Human |
Target Species | Human |
Epitope | Located in the sequence: MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN. |
Affinity | The affinity is in nanomolar range, about 3.9 nM, determined by surface plasmon resonance. |
Isotype | IgG |
Expression Species | HEK293F or CHO Cell line |
Conjugation | Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form. |
Purity | >95%, determined by SDS-PAGE and SEC-HPLC |
Endotoxin | <1 EU/mg, determined by LAL method |
Purification | Purified with Protein A or G affinity chromatography |
Sterility | 0.2 μM filtered |
Formulation | PBS, pH 7.4 |
Preservation | No preservatives |
Stabilizer | No stabilizers |
Storage | Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
Application | ELISA |
ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
WB | Western Blot Protocol |
FC | Flow Cytometry Protocol |