| Sub Cat | Epitope | Isotype | Application | Affinity | |
|---|---|---|---|---|---|
| V3S-1124-YC293 | IgG2a kappa | ELISA; Neut | |||
| V3S-0522-YC4056 | IgG2a | ELISA; Neut | |||
| V3S-0522-YC4652 | The epitope contains residues A241, K421. | IgG | ELISA; FuncS | 12.1 nM | |
| V3S-0522-YC4807 | The epitope contains residues S190, L258, K272. | IgG | ELISA; FuncS | ||
| V3S-0522-YC4578 | The epitope contains residues N216, N262, N268, K272. | IgG | ELISA; FuncS | ||
| V3S-0522-YC4950 | The epitope contains residues N216, N262, N268, K272. | IgG | IF | ||
| V3S-0522-YC4649 | The epitope contains residues F32, K272. | IgG | ELISA; FuncS | 54.1 pM | |
| V3S-0522-YC4648 | The epitope contains residue K272. | IgG | ELISA; FuncS | ||
| V3S-0522-YC4650 | The epitope contains residue N262. | IgG | ELISA; FuncS | ||
| V3S-0522-YC4527 | The epitope contains residue N268. | IgG | ELISA; FuncS | ||
| V3S-0522-YC4646 | The epitope contains residue N276. | IgG | ELISA; FuncS | ||
| V3S-0522-YC4651 | The epitope contains residue P389. | IgG | ELISA; FuncS | ||
| V3S-0522-YC4515 | The epitope contains residue R429. | IgG | FC | ||
| V3S-0522-YC4647 | The epitope contains residue S275. | IgG | ELISA; FuncS | ||
| V3S-0522-YC4506 | Located in the sequence: REFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS. | IgG | ELISA | ||
| V3S-0522-YC4522 | Located in the sequence: CTASNKNRGIIKTFSNG. | IgG | ELISA |
| Description | This product is a monoclonal antibody derived from Mouse (Mus musculus), which can specifically recognize Human respiratory syncytial virus fusion protein. The antibody is expressed with mammalian cell transient expression system, serum-free and purified by affinity chromatography. The purity and integrity are tested via SDS-PAGE and SEC-HPLC analysis. Given an antigen, additional QC measures are also desired such as affinity testing and binding validation. Specifically, the antibody is provided in multiple formats for in vivo and in vitro assays. The Invivo version features greater than 95% purity, ultra-low endotoxin levels (<1 EU/mg or 0.1 EU/mg), and is preservative, stabilizer, and carrier protein-free. |
| Clonality | Monoclonal |
| Host Species | Mouse |
| Target Species | Respiratory Syncytial Virus (RSV) |
| Isotype | IgG2a, κ |
| Expression Species | HEK293F or CHO |
| Conjugation | None |
| Purity | >95%, determined by SDS-PAGE and/or SEC-HPLC |
| Endotoxin | <1 EU/mg, determined by LAL method |
| Purification | Protein A affinity purified |
| Sterility | 0.2 μM filtered |
| Formulation | PBS, pH 7.4 |
| Preservation | No preservatives |
| Stabilizer | No stabilizers |
| Storage | Store at 4⁰C within a week. For longer storage, aliquot and store at -20⁰C. |
| Application | ELISA; Neut |
| Application Notes | The antibody is recommended for detection of HRSV F by ELISA, Neut assays. |
| ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
| WB | Western Blot Protocol |
| FC | Flow Cytometry Protocol |
