| Description | This product is a recombinant Human antibody provided by CreativeBiolabs. The antibody is specific for Human T-lymphotropic virus 1 Envelope glycoprotein gp62 precursor. It can be used for HTLV1 GP62 detection in Western Blot (WB). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg. |
| Clonality | Monoclonal |
| Host Species | Human |
| Target Species | Human T-lymphotropic virus 1 strain ATK |
| Epitope | Located in the sequence: IVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCRFPN. |
| Isotype | IgG |
| Expression Species | HEK293F or CHO Cell line |
| Conjugation | Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form. |
| Purity | >95%, determined by SDS-PAGE and SEC-HPLC |
| Endotoxin | <1 EU/mg, determined by LAL method |
| Purification | Purified with Protein A or G affinity chromatography |
| Sterility | 0.2 μM filtered |
| Formulation | PBS, pH 7.4 |
| Preservation | No preservatives |
| Stabilizer | No stabilizers |
| Storage | Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
| Application | WB |
| ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
| WB | Western Blot Protocol |
| FC | Flow Cytometry Protocol |
| Target | HTLV1 GP62 |
| Alternative Name | Env; Envelope glycoprotein gp62; HTLV-1 (strain ATK) gp62; Human T-cell lymphotrophic virus type 1 (strain ATK) |
| UniProt | P03381 |
| Research Area | Microbiology |
