| Sub Cat | Epitope | Isotype | Application | |
|---|---|---|---|---|
| V3S-1124-YC902 | Located in the sequence: QSRGEAR. | IgG1 | ELISA | |
| V3S-1022-YC5327 | Located in the sequence: NMEDEADQYFSHDDPISSDQSRFGWFENK. | IgG | WB | |
| V3S-1022-YC5328 | Located in the sequence: SRASDARAAHLPTGTPLDID. | IgG | WB | |
| V3S-1022-YC5329 | Located in the sequence: NDRNLLD. | IgG | WB |
| Description | This product is a monoclonal antibody derived from Mouse (Mus musculus), which can specifically recognize Measles virus Nucleoprotein. The antibody is expressed with mammalian cell transient expression system, serum-free and purified by affinity chromatography. The purity and integrity are tested via SDS-PAGE and SEC-HPLC analysis. Given an antigen, additional QC measures are also desired such as affinity testing and binding validation. Specifically, the antibody is provided in multiple formats for in vivo and in vitro assays. The Invivo version features greater than 95% purity, ultra-low endotoxin levels (<1 EU/mg or 0.1 EU/mg), and is preservative, stabilizer, and carrier protein-free. |
| Clonality | Monoclonal |
| Host Species | Mouse |
| Target Species | Measles Virus (MeV) |
| Epitope | Located in the sequence: QSRGEAR. |
| Isotype | IgG1 |
| Expression Species | HEK293F or CHO |
| Conjugation | None |
| Purity | >95%, determined by SDS-PAGE and/or SEC-HPLC |
| Endotoxin | <1 EU/mg, determined by LAL method |
| Purification | Protein A affinity purified |
| Sterility | 0.2 μM filtered |
| Formulation | PBS, pH 7.4 |
| Preservation | No preservatives |
| Stabilizer | No stabilizers |
| Storage | Store at 4⁰C within a week. For longer storage, aliquot and store at -20⁰C. |
| Application | ELISA |
| Application Notes | The antibody is recommended for detection of MeV NP by ELISA assay. |
| ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
| WB | Western Blot Protocol |
| FC | Flow Cytometry Protocol |
| Target | MeV NP |
| Alternative Name | MeV NP; Measles virus Nucleoprotein; MeV; Measles virus; Nucleoprotein; NP |
| UniProt | P04851 |
| Research Area | Microbiology |
| Related Disease | Measles |
