Recombinant Anti-MeV NP Antibody (V3S-0522-YC4532) (CAT#: V3S-0522-YC4532)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Sub Cat Epitope Isotype Application  
V3S-1124-YC902 Located in the sequence: QSRGEAR. IgG1 ELISA Inquiry
V3S-1022-YC5327 Located in the sequence: NMEDEADQYFSHDDPISSDQSRFGWFENK. IgG WB Inquiry
V3S-1022-YC5328 Located in the sequence: SRASDARAAHLPTGTPLDID. IgG WB Inquiry
V3S-1022-YC5329 Located in the sequence: NDRNLLD. IgG WB Inquiry
Summary
Property
Applications
Protocols
Target

Summary

Description This product is a monoclonal antibody derived from Mouse (Mus musculus), which can specifically recognize Measles virus Nucleoprotein. The antibody is expressed with mammalian cell transient expression system, serum-free and purified by affinity chromatography. The purity and integrity are tested via SDS-PAGE and SEC-HPLC analysis. Given an antigen, additional QC measures are also desired such as affinity testing and binding validation.
Specifically, the antibody is provided in multiple formats for in vivo and in vitro assays. The Invivo version features greater than 95% purity, ultra-low endotoxin levels (<1 EU/mg or 0.1 EU/mg), and is preservative, stabilizer, and carrier protein-free.
Clonality Monoclonal
Host Species Mouse
Target Species Measles Virus (MeV)
Epitope Located in the sequence: QSRGEAR.
Isotype IgG1

Property

Expression Species HEK293F or CHO
Conjugation None
Purity >95%, determined by SDS-PAGE and/or SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Protein A affinity purified
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4⁰C within a week. For longer storage, aliquot and store at -20⁰C.

Applications

Application ELISA
Application Notes The antibody is recommended for detection of MeV NP by ELISA assay.

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target MeV NP
Alternative Name MeV NP; Measles virus Nucleoprotein; MeV; Measles virus; Nucleoprotein; NP
UniProt P04851
Research Area Microbiology
Related Disease Measles
For research use only, not directly for clinical use.
banner banner
© 2026 Creative Biolabs. All Rights Reserved.
antibody
ISO 9001 Certified - Creative Biolabs Quality Management System.
Online Inquiry