Recombinant Anti-TTYH1 (aa 111-124) Antibody (V3S-0522-YC2034) (CAT#: V3S-0522-YC2034)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Summary
Property
Applications
Protocols
Target

Summary

Description This product is a monoclonal antibody derived from Mouse (Mus musculus), which can specifically recognize Tweety Family Member 1. The antibody is expressed with mammalian cell transient expression system, serum-free and purified by affinity chromatography. The purity and integrity are tested via SDS-PAGE and SEC-HPLC analysis. Given an antigen, additional QC measures are also desired such as affinity testing and binding validation.
Specifically, the antibody is provided in multiple formats for in vivo and in vitro assays. The Invivo version features greater than 95% purity, ultra-low endotoxin levels (<1 EU/mg or 0.1 EU/mg), and is preservative, stabilizer, and carrier protein-free.
Clonality Monoclonal
Host Species Mouse
Target Species Mouse
Immunogen Recombinant mouse Ttyhl molecule comprises native mouse Ttyhl molecules of 111 to 124 amino acids (111-GNSETSDGVSQLSSALLHANHTLSTIDDVVLETVERLGEAVKTELTTLEEVLSVRMELVAATRGA RRQAEAAAQYLQGLAFWQGVSLSPVQVAEDVTFVEEYRW-124)
Epitope in the aa 111-124
Isotype IgG1, κ

Property

Expression Species HEK293F or CHO
Conjugation None
Purity >95%, determined by SDS-PAGE and/or SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Protein A affinity purified
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4⁰C within a week. For longer storage, aliquot and store at -20⁰C.

Applications

Application WB; IF; IHC
Application Notes The antibody is recommended for detection of TTYH1 by WB, IF, IHC assays.

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target TTYH1
Alternative Name Tweety Family Member 1; HTTY1; Tweety (Drosophila) Homolog 1; Tweety Homolog 1 (Drosophila); Protein Tweety Homolog 1; Tweety Homolog 1;
Gene ID 57776
UniProt Q9D3A9
Research Area Signal Pathway
For research use only, not directly for clinical use.
banner banner
© 2024 Creative Biolabs. All Rights Reserved.
antibody
Online Inquiry