| Sub Cat | Epitope | |
|---|---|---|
| V3S-1124-YC2121 | Located in the sequence: LKSAQETDETSVDKYIRGL. | |
| V3S-0522-YC4655 | Located in the sequence: FDANNAHVYPGALVLANKDLAKGSPTSIGIARAPQTVSVDLPGL. | |
| V3S-0522-YC4656 | Located in the sequence: VEAGEATGLAWDPWWTVIN. |
| Description | This product is a monoclonal antibody derived from Mouse (Mus musculus), which can specifically recognize Arcanobacterium pyogenes Strain 42 Pyolysin. The antibody is expressed with mammalian cell transient expression system, serum-free and purified by affinity chromatography. The purity and integrity are tested via SDS-PAGE and SEC-HPLC analysis. Given an antigen, additional QC measures are also desired such as affinity testing and binding validation. Specifically, the antibody is provided in multiple formats for in vivo and in vitro assays. The Invivo version features greater than 95% purity, ultra-low endotoxin levels (<1 EU/mg or 0.1 EU/mg), and is preservative, stabilizer, and carrier protein-free. |
| Clonality | Monoclonal |
| Host Species | Mouse |
| Target Species | Arcanobacterium pyogenes Strain 42 |
| Epitope | Located in the sequence: LKSAQETDETSVDKYIRGL. |
| Isotype | IgG |
| Expression Species | HEK293F or CHO |
| Conjugation | None |
| Purity | >95%, determined by SDS-PAGE and/or SEC-HPLC |
| Endotoxin | <1 EU/mg, determined by LAL method |
| Purification | Protein A affinity purified |
| Sterility | 0.2 μM filtered |
| Formulation | PBS, pH 7.4 |
| Preservation | No preservatives |
| Stabilizer | No stabilizers |
| Storage | Store at 4⁰C within a week. For longer storage, aliquot and store at -20⁰C. |
| Application | WB |
| Application Notes | The antibody is recommended for detection of A. pyogenes Pyolysin by WB assay. |
| ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
| WB | Western Blot Protocol |
| FC | Flow Cytometry Protocol |
| Target | A. pyogenes Pyolysin |
| Alternative Name | A. pyogenes-42 Pyolysin; Arcanobacterium pyogenes Strain 42 Pyolysin; A. pyogenes-42; Arcanobacterium pyogenes Strain 42; Pyolysin; Pyolysin |
| UniProt | Q9S0W7 |
| Research Area | Microbiology |