Recombinant Anti-C. trachomatis MOMP Antibody (V3S-1022-YC5193) (CAT#: V3S-1022-YC5193)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Sub Cat Target Species Epitope Isotype Application  
V3S-1124-YC696 Chlamydia trachomatis Serovar B Located in the sequence: FDVTTLNPTIAGAGDVK. IgG2b WB Inquiry
V3S-1022-YC5191 Chlamydia trachomatis Serovar B Located in the sequence: PTIAGAGDVKTSAEG. IgG WB Inquiry
V3S-1022-YC5320 Chlamydia trachomatis Serovar L1 Located in the sequence: IFDT. IgG WB Inquiry
V3S-1022-YC5323 Chlamydia trachomatis Serovar L1 Located in the sequence: IFDT. IgG ELISA Inquiry
V3S-1022-YC5192 Chlamydia trachomatis Serovar L2 Located in the sequence: AEGQLG. IgG3 WB Inquiry
V3S-1022-YC5194 Chlamydia trachomatis Serovar L2 Located in the sequence: SATTVFDVTTLNPTIAGAGDVKASAEGQLG. IgG WB Inquiry
V3S-1022-YC4460 Chlamydia trachomatis Serovar H Located in the sequence: LQND. IgG2a ELISA Inquiry
Summary
Property
Applications
Protocols
Target

Summary

Description This product is a recombinant Mouse antibody provided by CreativeBiolabs. The antibody is specific for Chlamydia trachomatis Major outer membrane protein. It can be used for C. trachomatis MOMP detection in Western Blot (WB). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg.
Clonality Monoclonal
Host Species Mouse
Target Species Chlamydia trachomatis Serovar B
Epitope Located in the sequence: FDVTTLNPTIAGAGDVK.
Isotype IgG2b

Property

Expression Species HEK293F or CHO Cell line
Conjugation Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form.
Purity >95%, determined by SDS-PAGE and SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Purified with Protein A or G affinity chromatography
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics.

Applications

Application WB

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target C. trachomatis MOMP
Alternative Name C. trachomatis B MOMP; Chlamydia trachomatis Serovar B; C. trachomatis B; MOMP; Major outer membrane porin
UniProt P23421
Research Area Microbiology
For research use only, not directly for clinical use.
banner banner
© 2024 Creative Biolabs. All Rights Reserved.
antibody
ISO 9001 Certified - Creative Biolabs Quality Management System.
Online Inquiry