Anti-CD274 (aa 68-128) Neutralizing Antibody (V3S-0522-YC3136) (CAT#: V3S-0522-YC3136)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Summary
Property
Applications
Protocols
Target

Summary

Description This product is a monoclonal antibody derived from Mouse (Mus musculus), which can specifically recognize CD274 molecule. The antibody is expressed with mammalian cell transient expression system, serum-free and purified by affinity chromatography. The purity and integrity are tested via SDS-PAGE and SEC-HPLC analysis. Given an antigen, additional QC measures are also desired such as affinity testing and binding validation.
Specifically, the antibody is provided in multiple formats for in vivo and in vitro assays. The Invivo version features greater than 95% purity, ultra-low endotoxin levels (<1 EU/mg or 0.1 EU/mg), and is preservative, stabilizer, and carrier protein-free.
Clonality Monoclonal
Host Species Mouse
Target Species Human
Epitope The epitope was determined to be conformational and not linear. The epitope includes amino acid residues H69, Y112, R113 and K124, which are underlined in the sequence starting with V68 and ending with V128 (VHGEEDLKVQHDAGVYRCMISYGGADYKRITV).
Isotype IgG

Property

Expression Species HEK293F or CHO
Conjugation None
Purity >95%, determined by SDS-PAGE and/or SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Protein A affinity purified
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4⁰C within a week. For longer storage, aliquot and store at -20⁰C.

Applications

Application FC; Block; IHC; WB
Application Notes The antibody is recommended for detection of CD274 by FC, Block, IHC, WB assays.

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target CD274
Alternative Name CD274 Molecule; CD274 Antigen; B7 Homolog 1; Programmed Cell Death 1 Ligand 1; PDCD1 Ligand 1; PDCD1LG1; PDCD1L1;
Gene ID 29126
UniProt Q9NZQ7
Research Area Immunology
For research use only, not directly for clinical use.
banner banner
© 2024 Creative Biolabs. All Rights Reserved.
antibody
ISO 9001 Certified - Creative Biolabs Quality Management System.
Online Inquiry