Recombinant Anti-HIV1 Antibody (V3S-0522-YC8070) (CAT#: V3S-0522-YC8070)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Sub Cat Immunogen Isotype Application  
V3S-1124-YC1048 IgG WB; IHC; IF; FuncS Inquiry
V3S-0522-YC8130 Peptide RP70: INC*TRPNYNKRKRIHIGPGRAFYTTKNIIGTIRQAHC*NIS with a disulfide bond between the two C* residues. IgG1 lambda WB; ELISA; FuncS Inquiry
Summary
Property
Applications
Protocols
Target

Summary

Description This product is a monoclonal antibody derived from Mouse (Mus musculus), which can specifically recognize Human immunodeficiency virus 1. The antibody is expressed with mammalian cell transient expression system, serum-free and purified by affinity chromatography. The purity and integrity are tested via SDS-PAGE and SEC-HPLC analysis. Given an antigen, additional QC measures are also desired such as affinity testing and binding validation.
Specifically, the antibody is provided in multiple formats for in vivo and in vitro assays. The Invivo version features greater than 95% purity, ultra-low endotoxin levels (<1 EU/mg or 0.1 EU/mg), and is preservative, stabilizer, and carrier protein-free.
Clonality Monoclonal
Host Species Mouse
Target Species Human immunodeficiency virus 1 (HIV1)
Isotype IgG

Property

Expression Species HEK293F or CHO
Conjugation None
Purity >95%, determined by SDS-PAGE and/or SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Protein A affinity purified
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4⁰C within a week. For longer storage, aliquot and store at -20⁰C.

Applications

Application WB; IHC; IF; FuncS
Application Notes The antibody is recommended for detection of HIV1 by WB, IHC, IF, FuncS assays.

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target HIV1
Alternative Name HIV-1; human immunodeficiency virus
Research Area Microbiology; Infectious Disease
For research use only, not directly for clinical use.
banner banner
© 2026 Creative Biolabs. All Rights Reserved.
antibody
ISO 9001 Certified - Creative Biolabs Quality Management System.
Online Inquiry