Anti-HPV1 VP1 Neutralizing Antibody (V3S-1022-YC5169) (CAT#: V3S-1022-YC5169)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Sub Cat Epitope Application  
V3S-1124-YC1496 Located in the sequence: STTNK. Block; ELISA Inquiry
V3S-1022-YC5170 Located in the sequence: DNPASTTNKDKLFAVWKITYKDTV. Block; ELISA Inquiry
V3S-1022-YC5198 The epitope contains residue E40. WB Inquiry
V3S-1022-YC5195 Located in the sequence: WCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY. WB Inquiry
V3S-1022-YC5196 Located in the sequence: IPALTAVETGATNPL. WB Inquiry
V3S-1022-YC5197 Located in the sequence: YGPGVDY. WB Inquiry
V3S-1022-YC5199 Located in the sequence: VPSDTVQTRHVV. IP Inquiry
V3S-1022-YC5200 Located in the sequence: YGPGVDY. ELISA Inquiry
Summary
Property
Applications
Protocols
Target

Summary

Description This product is a recombinant Mouse antibody provided by CreativeBiolabs. The antibody is specific for Human papillomavirus-1 Capsid protein VP1. It can be used for HPV1 VP1 detection in Blocking (Block), Enzyme-linked Immunosorbent Assay (ELISA). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg.
Clonality Monoclonal
Host Species Mouse
Target Species Human papillomavirus 1 (HPV1)
Epitope Located in the sequence: STTNK.
Isotype IgG

Property

Expression Species HEK293F or CHO Cell line
Conjugation Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form.
Purity >95%, determined by SDS-PAGE and SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Purified with Protein A or G affinity chromatography
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics.

Applications

Application Block; ELISA

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target HPV1 VP1
Alternative Name HPV-1 Capsid VP1; Human papillomavirus-1; HPV-1; Capsid VP1; Capsid protein VP1
Research Area Microbiology
For research use only, not directly for clinical use.
banner banner
© 2025 Creative Biolabs. All Rights Reserved.
antibody
ISO 9001 Certified - Creative Biolabs Quality Management System.
Online Inquiry