Sub Cat | Epitope | Isotype | Application | |
---|---|---|---|---|
V3S-1124-YC886 | Located in the sequence: PPTAPPLLPHSNL. | IgG3 | ELISA | |
V3S-0522-YC4404 | Located in the sequence: PPTAPPLLPHSNL. | IgG1 | WB | |
V3S-0522-YC4405 | Located in the sequence: PPTAPPLLPHSNL. | IgG3 | ELISA; FuncS | |
V3S-0522-YC4406 | Located in the sequence: PPTAPPLLPHSNL. | IgG1 | ELISA; FuncS | |
V3S-0522-YC4413 | Located in the sequence: STWHVLYSPNVSVPSSSSTP. | IgG1 | ELISA | |
V3S-1022-YC5283 | Located in the sequence: LALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLI. | IgG1 | ELISA | |
V3S-1022-YC5284 | Located in the sequence: PPLLPH. | IgG | ELISA |
Description | This product is a monoclonal antibody derived from Human (Homo sapiens), which can specifically recognize Human T-lymphotropic virus 1 Envelope glycoprotein. The antibody is expressed with mammalian cell transient expression system, serum-free and purified by affinity chromatography. The purity and integrity are tested via SDS-PAGE and SEC-HPLC analysis. Given an antigen, additional QC measures are also desired such as affinity testing and binding validation. Specifically, the antibody is provided in multiple formats for in vivo and in vitro assays. The Invivo version features greater than 95% purity, ultra-low endotoxin levels (<1 EU/mg or 0.1 EU/mg), and is preservative, stabilizer, and carrier protein-free. |
Clonality | Monoclonal |
Host Species | Human |
Target Species | Human T-lymphotropic Virus 1 (HTLV1) |
Epitope | Located in the sequence: PPTAPPLLPHSNL. |
Isotype | IgG3 |
Expression Species | HEK293F or CHO |
Conjugation | None |
Purity | >95%, determined by SDS-PAGE and/or SEC-HPLC |
Endotoxin | <1 EU/mg, determined by LAL method |
Purification | Protein A affinity purified |
Sterility | 0.2 μM filtered |
Formulation | PBS, pH 7.4 |
Preservation | No preservatives |
Stabilizer | No stabilizers |
Storage | Store at 4⁰C within a week. For longer storage, aliquot and store at -20⁰C. |
Application | ELISA |
Application Notes | The antibody is recommended for detection of HTLV1 Env by ELISA assay. |
ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
WB | Western Blot Protocol |
FC | Flow Cytometry Protocol |
Target | HTLV1 Env |
Alternative Name | HTLV-1 Env; Human T-lymphotropic virus 1 Envelope glycoprotein; HTLV-1; Human T-lymphotropic virus 1; Envelope glycoprotein; Env |
UniProt | A45714 |
Research Area | Microbiology; Infectious Disease |