Recombinant Anti-HTLV1 Env Antibody (V3S-0522-YC4385) (CAT#: V3S-0522-YC4385)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Sub Cat Epitope Isotype Application  
V3S-1124-YC886 Located in the sequence: PPTAPPLLPHSNL. IgG3 ELISA Inquiry
V3S-0522-YC4404 Located in the sequence: PPTAPPLLPHSNL. IgG1 WB Inquiry
V3S-0522-YC4405 Located in the sequence: PPTAPPLLPHSNL. IgG3 ELISA; FuncS Inquiry
V3S-0522-YC4406 Located in the sequence: PPTAPPLLPHSNL. IgG1 ELISA; FuncS Inquiry
V3S-0522-YC4413 Located in the sequence: STWHVLYSPNVSVPSSSSTP. IgG1 ELISA Inquiry
V3S-1022-YC5283 Located in the sequence: LALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLI. IgG1 ELISA Inquiry
V3S-1022-YC5284 Located in the sequence: PPLLPH. IgG ELISA Inquiry
Summary
Property
Applications
Protocols
Target

Summary

Description This product is a monoclonal antibody derived from Human (Homo sapiens), which can specifically recognize Human T-lymphotropic virus 1 Envelope glycoprotein. The antibody is expressed with mammalian cell transient expression system, serum-free and purified by affinity chromatography. The purity and integrity are tested via SDS-PAGE and SEC-HPLC analysis. Given an antigen, additional QC measures are also desired such as affinity testing and binding validation.
Specifically, the antibody is provided in multiple formats for in vivo and in vitro assays. The Invivo version features greater than 95% purity, ultra-low endotoxin levels (<1 EU/mg or 0.1 EU/mg), and is preservative, stabilizer, and carrier protein-free.
Clonality Monoclonal
Host Species Human
Target Species Human T-lymphotropic Virus 1 (HTLV1)
Epitope Located in the sequence: PPTAPPLLPHSNL.
Isotype IgG3

Property

Expression Species HEK293F or CHO
Conjugation None
Purity >95%, determined by SDS-PAGE and/or SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Protein A affinity purified
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4⁰C within a week. For longer storage, aliquot and store at -20⁰C.

Applications

Application ELISA
Application Notes The antibody is recommended for detection of HTLV1 Env by ELISA assay.

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target HTLV1 Env
Alternative Name HTLV-1 Env; Human T-lymphotropic virus 1 Envelope glycoprotein; HTLV-1; Human T-lymphotropic virus 1; Envelope glycoprotein; Env
UniProt A45714
Research Area Microbiology; Infectious Disease
For research use only, not directly for clinical use.
banner banner
© 2024 Creative Biolabs. All Rights Reserved.
antibody
ISO 9001 Certified - Creative Biolabs Quality Management System.
Online Inquiry