Recombinant Anti-HTLV1 Env Antibody (V3S-1022-YC5074) (CAT#: V3S-1022-YC5074)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Sub Cat Epitope Isotype Application  
V3S-1124-YC888 Located in the sequence: APPLLPHSNLDHIL. IgG ELISA Inquiry
V3S-1022-YC5176 Located in the sequence: FLNTEPSQLPPTAPPLLPHSNLDHI. IgG2 ELISA Inquiry
V3S-1022-YC5178 Located in the sequence: TPLLYPSLALPAPHLTLPFNWTHCFDPQIQ. IgG2 ELISA Inquiry
V3S-1022-YC5179 Located in the sequence: PCHNSLILPPFSLSPVPTLGSRSRR. IgG2 IF Inquiry
Summary
Property
Applications
Protocols
Target

Summary

Description This product is a recombinant Rat antibody provided by CreativeBiolabs. The antibody is specific for Human T-lymphotropic virus 1 Envelope glycoprotein. It can be used for HTLV1 Env detection in Enzyme-linked Immunosorbent Assay (ELISA). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg.
Clonality Monoclonal
Host Species Rat
Target Species Human T-lymphotropic virus 1 (HTLV1)
Epitope Located in the sequence: APPLLPHSNLDHIL.
Isotype IgG

Property

Expression Species HEK293F or CHO Cell line
Conjugation Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form.
Purity >95%, determined by SDS-PAGE and SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Purified with Protein A or G affinity chromatography
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics.

Applications

Application ELISA

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target HTLV1 Env
Alternative Name HTLV-1 Env; Human T-lymphotropic virus 1; HTLV-1; Env; Envelope protein
UniProt A45714
Research Area Microbiology
For research use only, not directly for clinical use.
banner banner
© 2024 Creative Biolabs. All Rights Reserved.
antibody
ISO 9001 Certified - Creative Biolabs Quality Management System.
Online Inquiry