Sub Cat | Target Species | Epitope | Isotype | Application | |
---|---|---|---|---|---|
V3S-1124-YC700 | Rat, Human | IgG1 | Neut; WB | ||
V3S-0822-YC1891 | Human | IgG1 | Neut; WB | ||
V3S-0522-YC4928 | Human | Located in the sequence: VPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECG. | IgG2b | WB |
Description | This product is a mouse monoclonal antibody provided by Creative Biolabs. The antibody is capable of recognizing inhibin beta A subunit. It can be used for INHBA detection in Neutralization Assay (Neut), Western Blot (WB). The antibody is expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg. |
Clonality | Monoclonal |
Host Species | Mouse |
Target Species | Rat, Human |
Immunogen | Recombinant full length protein corresponding to Human Activin A. |
Isotype | IgG1 |
Conjugation | Unconjugated |
Purity | >95%, determined by SDS-PAGE |
Purification | Protein G purified |
Storage | Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
Application | Neut; WB |
ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
WB | Western Blot Protocol |
FC | Flow Cytometry Protocol |