Anti-LDV GP5 Neutralizing Antibody (V3S-1022-YC4034) (CAT#: V3S-1022-YC4034)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Sub Cat Isotype  
V3S-1124-YC2051 IgG1 Inquiry
V3S-1022-YC4035 IgG3 Inquiry
Summary
Property
Applications
Protocols
Target

Summary

Description This product is a recombinant Mouse antibody provided by CreativeBiolabs. The antibody is specific for Lactate dehydrogenase elevating virus Plagemann major structural glycoprotein GP5. It can be used for LDV GP5 detection in Neutralization (Neut). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg.
Clonality Monoclonal
Host Species Mouse
Target Species LDV Plagemann
Epitope Located in the sequence: ACAAGNSSTKNLIYNLTLCELNVTGFQQHF.
Isotype IgG1

Property

Expression Species HEK293F or CHO Cell line
Conjugation Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form.
Purity >95%, determined by SDS-PAGE and SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Purified with Protein A or G affinity chromatography
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics.

Applications

Application Neut

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target LDV GP5
Alternative Name GP5; Major structural glycoprotein; LDV Plagemann GP5; Lactate dehydrogenase elevating virus Plagemann
Gene ID 4783126
UniProt Q83022
Research Area Microbiology
For research use only, not directly for clinical use.
banner banner
© 2024 Creative Biolabs. All Rights Reserved.
antibody
ISO 9001 Certified - Creative Biolabs Quality Management System.
Online Inquiry