| Sub Cat | Epitope | Isotype | Application | |
|---|---|---|---|---|
| V3S-1124-YC914 | A conformational epitope (31, 34, 40, 43). | IgG | ELISA; Block | |
| V3S-1022-YC4188 | In the first EGF domain. | IgG | ELISA; Block | |
| V3S-0522-YC4317 | The epitope contains residues Q1529, H1530, Q1531, C1532, Q1539, N1540, S1541, L1547, E1549, R1550, C1555, L1557, A1583, D1584, C1601, C1603, K1605, D1607, S1608, Y1609, F1612, D1613, S1618. | IgG1 | ELISA | |
| V3S-0522-YC4318 | The epitope contains residues H1530, Q1531, C1532, Q1539, N1540, S1541, C1543, H1546, L1547, E1549, R1550, E1551, C1553, L1557, N1558, E1562, K1565, C1566, C1601, K1605, S1608, F1612, D1613. | IgG2b | ELISA | |
| V3S-0522-YC4316 | The epitope contains residues L1557, N1558, Q1561, C1574, N1575, E1576, N1577, N1578, G1579, G1580, A1583, D1584, C1587, D1591, S1592, G1593, S1594, N1595, G1596, K1597, I1599, C1603, T1604. | IgG1 | ELISA | |
| V3S-1022-YC4937 | The epitope contains residues T1648, S1657, R1658. | IgG | ELISA | |
| V3S-1022-YC4964 | The epitope contains residues T1648, E1652, S1657, R1658. | IgG | IF | |
| V3S-1022-YC4190 | Located in the sequence: YSLFQKEKMVL. | IgG1 | ELISA; IHC | |
| V3S-1022-YC4926 | Located in the sequence: NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT. | IgG | WB |
| Description | This product is a recombinant Mouse antibody provided by CreativeBiolabs. The antibody is specific for Plasmodium falciparum Merozoite surface protein 1 precursor. It can be used for P. falciparum MSP1 detection in Enzyme-linked Immunosorbent Assay (ELISA), Blocking (Block). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg. |
| Clonality | Monoclonal |
| Host Species | Mouse |
| Target Species | Plasmodium falciparum |
| Epitope | This antibody recognizes a conformational epitope (31, 34, 40, 43). |
| Isotype | IgG |
| Expression Species | HEK293F or CHO Cell line |
| Conjugation | Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form. |
| Purity | >95%, determined by SDS-PAGE and SEC-HPLC |
| Endotoxin | <1 EU/mg, determined by LAL method |
| Purification | Purified with Protein A or G affinity chromatography |
| Sterility | 0.2 μM filtered |
| Formulation | PBS, pH 7.4 |
| Preservation | No preservatives |
| Stabilizer | No stabilizers |
| Storage | Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics. |
| Application | ELISA; Block |
| ELISA | Enzyme-Linked Immunosorbent Assay Protocol |
| WB | Western Blot Protocol |
| FC | Flow Cytometry Protocol |
| Target | P. falciparum MSP1 |
| Alternative Name | MSP-1; Merozoite surface protein 1; P. falciparum MSP-1; Plasmodium falciparum |
| UniProt | A0SJG1 |
| Research Area | Microbiology |
