Recombinant Anti-PRNP Antibody (V3S-1022-YC4795) (CAT#: V3S-1022-YC4795)

Send Inquiry
  • fig1

Datasheet

MSDS

COA

Sub Cat Epitope Isotype Application  
V3S-1124-YC921 The epitope contains residues N155, N170. IgG1 WB Inquiry
V3S-1022-YC3556 Located in the sequence: EDRYYRENM. IgG ELISA Inquiry
V3S-1022-YC3560 Located in the sequence: GAVVGGLGGYML. IgG1 ELISA; WB; IHC Inquiry
V3S-1022-YC3561 Located in the sequence: DWEDRYYRENMNR. IgG FC Inquiry
V3S-1022-YC3562 Located in the sequence: AMSRPMMHFGNDWEDRYYRENMNRYPNQVYY. IgG1 FC Inquiry
V3S-1022-YC3564 Located in the sequence: GWGQPHGGGWGQPHG. IgG FC; ELISA Inquiry
V3S-1022-YC3565 Located in the sequence: KPSKPKTNMKHMAGA. IgG2b Inhib Inquiry
V3S-1022-YC3566 Located in the sequence: KPSKPKTNMKHMAGA. IgG1 Inhib Inquiry
V3S-1022-YC3567 Located in the sequence: PMMHFGNDWEDRYYR. IgG1 WB Inquiry
Summary
Property
Applications
Protocols
Target

Summary

Description This product is a recombinant Mouse antibody provided by CreativeBiolabs. The antibody is specific for PRioN Protein. It can be used for PRNP detection in Western Blot (WB). It was expressed in mammalian cells (293F or CHO) with antibody encoding genes and purified by affinity chromatography. Each lot of this antibody is quality control tested by SDS-PAGE and SEC-HPLC analysis. For highly sensitive assays, we recommend the ultra purified form of the product, which has a lower endotoxin limit than standard antibody, less than 1 EU/mg or even 0.1 EU/mg.
Clonality Monoclonal
Host Species Mouse
Target Species Hamster
Epitope The epitope contains residues N155, N170.
Isotype IgG1

Property

Expression Species HEK293F or CHO Cell line
Conjugation Unconjugated, also available for Biotin, HRP, FITC and PE-labeled form.
Purity >95%, determined by SDS-PAGE and SEC-HPLC
Endotoxin <1 EU/mg, determined by LAL method
Purification Purified with Protein A or G affinity chromatography
Sterility 0.2 μM filtered
Formulation PBS, pH 7.4
Preservation No preservatives
Stabilizer No stabilizers
Storage Store at 4°C within one or two weeks. Store at -20°C for long term. Avoid repeated freeze/thaw cycles. Refer to the COA file for specifics.

Applications

Application WB

Protocols

ELISA Enzyme-Linked Immunosorbent Assay Protocol
WB Western Blot Protocol
FC Flow Cytometry Protocol

Target

Target PRNP
Alternative Name PRNP; prion protein; CJD; GSS; PrP; ASCR; KURU; PRIP; PrPc; CD230; AltPrP; p27-30; PrP27-30; PrP33-35C
Gene ID 101829062
UniProt P04273
Research Area Microbiology
For research use only, not directly for clinical use.
banner banner
© 2026 Creative Biolabs. All Rights Reserved.
antibody
ISO 9001 Certified - Creative Biolabs Quality Management System.
Online Inquiry